PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G035498.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family MYB
Protein Properties Length: 526aa    MW: 58121.6 Da    PI: 7.529
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G035498.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.82.5e-181461148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g W++eEde+l+++++++G g+W+++++  g+ R++k+c++rw +yl
  HL.SW.v1.0.G035498.1 14 KGLWSPEEDEKLLNYITKHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                          678*******************************************97 PP

2Myb_DNA-binding44.73.2e-1467110146
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           rg+++++E+ l++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
  HL.SW.v1.0.G035498.1  67 RGPFSQQEENLIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                           89********************.*********.*********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-27664IPR009057Homeodomain-like
PROSITE profilePS5129425.407965IPR017930Myb domain
SuperFamilySSF466897.03E-3012108IPR009057Homeodomain-like
SMARTSM007172.2E-131363IPR001005SANT/Myb domain
PfamPF002494.2E-161461IPR001005SANT/Myb domain
CDDcd001674.18E-121761No hitNo description
Gene3DG3DSA:1.10.10.601.6E-2565116IPR009057Homeodomain-like
PROSITE profilePS5129420.42166116IPR017930Myb domain
SMARTSM007171.2E-1266114IPR001005SANT/Myb domain
PfamPF002494.3E-1367110IPR001005SANT/Myb domain
CDDcd001672.24E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010089Biological Processxylem development
GO:0010119Biological Processregulation of stomatal movement
GO:0010214Biological Processseed coat development
GO:0048364Biological Processroot development
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 526 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLNYIT KHGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGPF SQQEENLIIE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CIKKKLRQKG  120
IDPNTHKPLS EVENDIGKLD KASSMTNKAG NNNNENNSTV KASSLGTLSN DHHHHHHHHL  180
NLAESQPSIT IDRYPLLEVS SATPPTQEFF IEKSDVVSNT TSSCRPSDFA SYFSFHSNNY  240
GTTSSSQDQN NNNNMASFCF NINQSSTTST RPPPSSNSNN LSPVHHHHHH HQQQQHDHHH  300
HHHQMISSLI PPPVSSCSIF SSSPSSTTSS SSPTNPRVKP SISLPLSDHQ NPSTVSCEVN  360
NNNGVVVQNW EASTFSNNGS SSSSCNIELQ SQGNNFFDNS NSTTAAAATA AAATTTVPPN  420
AANFSWGLVP ESGTIKSDDP EDIKWSEYLH SPFLLGAASN NQNSSQPILY SNIVKPESHF  480
TTGSNSTWHQ NEHNHHHHQL QAASSEIMYT NKDLQRLAVA FGQTL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00134DAPTransfer from AT1G09540Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007207615.11e-138hypothetical protein PRUPE_ppa019718mg
TrEMBLM5W5301e-138M5W530_PRUPE; Uncharacterized protein
STRINGPOPTR_0005s00340.11e-133(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G57560.18e-89myb domain protein 50